DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and WNT9A

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_003386.1 Gene:WNT9A / 7483 HGNCID:12778 Length:365 Species:Homo sapiens


Alignment Length:433 Identity:137/433 - (31%)
Similarity:199/433 - (45%) Gaps:117/433 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EPNNITPIMYMDPAIHS----------TLRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNR 100
            ||..|.|:. ::|...:          .|.|||||:.|.:|||...||:..:::..|||.|||..
Human    37 EPLTILPLT-LEPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFE 100

  Fly   101 RWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSP 165
            ||||:.....|     ..::.||.:||:|:|||:||.:||::|:|||.|.:|.||||.:....:.
Human   101 RWNCTLEGRYR-----ASLLKRGFKETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENR 160

  Fly   166 QANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGER-GRNLREKMNLHNNEAGRAHVQAEM 229
            :|            |:||||.||:.:..||.:||:  |.| .::||.:::.|||..|...::|.:
Human   161 EA------------WQWGGCGDNLKYSSKFVKEFL--GRRSSKDLRARVDFHNNLVGVKVIKAGV 211

  Fly   230 RQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSN 294
            ...|||||:||||||:|||.:||.|..:|.:||.:::.|.:|..|.:..|..|.|...|....|.
Human   212 ETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASG 276

  Fly   295 SVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGR 359
            :.||:.|                                                          
Human   277 AGGSDPL---------------------------------------------------------- 283

  Fly   360 RQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCG 424
                          |..||        ||:|:.|||||...  :...||.||:|:...    .|.
Human   284 --------------PRTPE--------LVHLDDSPSFCLAG--RFSPGTAGRRCHREK----NCE 320

  Fly   425 LMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC 467
            .:|||||:.....||...|.|...|||.|:|:.|..::.:|||
Human   321 SICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 132/405 (33%)
WNT9ANP_003386.1 Wnt 64..364 CDD:393294 132/405 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..287 9/98 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.