DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and WNT2B

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_078613.1 Gene:WNT2B / 7482 HGNCID:12781 Length:391 Species:Homo sapiens


Alignment Length:434 Identity:154/434 - (35%)
Similarity:212/434 - (48%) Gaps:118/434 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WWGIAKVGEP---NNITPIMYMDPAIHSTLRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRN 99
            ||.|..:|..   :||       |.:.|    :||:|.:..|.::.::.:||...|.|||||||:
Human    60 WWYIGALGARVICDNI-------PGLVS----RQRQLCQRYPDIMRSVGEGAREWIRECQHQFRH 113

  Fly   100 RRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRS 164
            .||||:|  ..|...:||:::.|..||.:|:|||:||.|.|:|.||||:|.:..|:||...:.|.
Human   114 HRWNCTT--LDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRH 176

  Fly   165 PQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGE-RGRNLREKMNLHNNEAGRAHVQAE 228
               :.|.|      |::||||||||.:|.:|::.|||..| |.::.|..||||||..||..|:..
Human   177 ---HDQRG------DFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRF 232

  Fly   229 MRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGS 293
            ::.||||||:|||||::|||..|::||..||.|:.|:|||.:|..|..               |:
Human   233 LKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQD---------------GA 282

  Fly   294 NSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNG 358
            |..                                                     |.::|.|..
Human   283 NFT-----------------------------------------------------AARQGYRRA 294

  Fly   359 RRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGC 423
            .|                        .||||.:.||.:|..:...|.|||.||.|::||.|.|||
Human   295 TR------------------------TDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGC 335

  Fly   424 GLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC 467
            .:|||||||....|..|.:|.|.|||||.|:||.||....::||
Human   336 EIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTC 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 146/405 (36%)
WNT2BNP_078613.1 wnt 74..380 CDD:306592 150/420 (36%)
WNT-core domain 107..379 136/374 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.