DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and WNT11

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_011543540.1 Gene:WNT11 / 7481 HGNCID:12776 Length:364 Species:Homo sapiens


Alignment Length:461 Identity:136/461 - (29%)
Similarity:192/461 - (41%) Gaps:149/461 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GSMWWGIAKVGEPNNITPIMYMDPAIHSTLRRKQR--------RLVRDNPGVLGALVKGANLAIS 91
            |..|..::|       ||...   |::.|...||.        :|.|.|..::..:|..|...:.
Human    24 GIKWLALSK-------TPSAL---ALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVVHAAREVMK 78

  Fly    92 ECQHQFRNRRWNCSTRNFSRGKNLFGKIVD------------RGCRETSFIYAITSAAVTHSIAR 144
            .|:..|.:.|||||:...:.     ..::|            .|.||::|:||:::||::|:|||
Human    79 ACRRAFADMRWNCSSIELAP-----NYLLDLERASADLPLPPSGTRESAFVYALSAAAISHAIAR 138

  Fly   145 ACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVD-------T 202
            ||:.|.:..|:|       .|......|  .|.|   ||||:||:.:|.....:|.|       |
Human   139 ACTSGDLPGCSC-------GPVPGEPPG--PGNR---WGGCADNLSYGLLMGAKFSDAPMKVKKT 191

  Fly   203 GERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDG 267
            |.:...|   |.|||:|.||..::|.:..:|||||:||||:::|||..|...:.:..:||.|:..
Human   192 GSQANKL---MRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAADLKTRYLS 253

  Fly   268 ATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHP 332
            ||:|                                                             
Human   254 ATKV------------------------------------------------------------- 257

  Fly   333 ISKIHHPNMPSPNSLPQAGQRGGRNGRRQG-RKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSF 396
               :|.|                     .| |||      |.|.:.:.:|....:||||:.||.|
Human   258 ---VHRP---------------------MGTRKH------LVPKDLDIRPVKDSELVYLQSSPDF 292

  Fly   397 CEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTK 461
            |.||.:.|..||..||||:||.|.|.|.||||||||......|||||.|.:||||.|.|:.|...
Human   293 CMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERT 357

  Fly   462 KVIYTC 467
            ...|.|
Human   358 VERYVC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 129/432 (30%)
WNT11XP_011543540.1 wnt 47..364 CDD:302926 128/428 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.