DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and WNT8A

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_016865313.1 Gene:WNT8A / 7478 HGNCID:12788 Length:408 Species:Homo sapiens


Alignment Length:390 Identity:127/390 - (32%)
Similarity:172/390 - (44%) Gaps:122/390 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 GANLAISECQHQFRNRRWNC-------STRNFSRGKNLFGKIVDRGCRETSFIYAITSAAVTHSI 142
            ||...|.||:.||...||||       ||.|..|.          ..||||||:||:||.|.:.|
Human    86 GAQSGIEECKFQFAWERWNCPENALQLSTHNRLRS----------ATRETSFIHAISSAGVMYII 140

  Fly   143 ARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGERGR 207
            .:.||.|..|:|.||.|:..::           |...|.|||||||:.||.:.|:.|||:.|:|:
Human   141 TKNCSMGDFENCGCDGSNNGKT-----------GGHGWIWGGCSDNVEFGERISKLFVDSLEKGK 194

  Fly   208 NLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQ 272
            :.|..||||||.|||..|:|.|::.|||||:||||:::|||::||.||.:||.|||::|.|.:::
Human   195 DARALMNLHNNRAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIE 259

  Fly   273 V-TNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPISKI 336
            : ...|||.|:               :.|..:|....:                           
Human   260 MDKRQLRAGNS---------------AEGHWVPAEAFL--------------------------- 282

  Fly   337 HHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNL 401
                                                        |....:|::||.||.:|..|.
Human   283 --------------------------------------------PSAEAELIFLEESPDYCTCNS 303

  Fly   402 RQGILGTHGRQCNETSLGVD-----GCGLMC--CGRGYRRDEVVVVERCACTFHWCCEVKCKLCR 459
            ..||.||.||:|.:.|....     .||.:|  ||......:..|:..|.|.|.|||.|||..||
Human   304 SLGIYGTEGRECLQNSHNTSRWERRSCGRLCTECGLQVEERKTEVISSCNCKFQWCCTVKCDQCR 368

  Fly   460  459
            Human   369  368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 127/390 (33%)
WNT8AXP_016865313.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.