DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and WNT7B

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_011528668.1 Gene:WNT7B / 7477 HGNCID:12787 Length:353 Species:Homo sapiens


Alignment Length:404 Identity:140/404 - (34%)
Similarity:190/404 - (47%) Gaps:99/404 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETS 128
            |..:||.:.:..|..:..:.:||.:.|:|||:|||..|||||...   .|.:||:.:..|.||.:
Human    48 LAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALG---EKTVFGQELRVGSREAA 109

  Fly   129 FIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGF 193
            |.||||:|.|.|::..|||:|.:.:|.||...|....||          ..|:|||||.::.:|.
Human   110 FTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQA----------EGWKWGGCSADVRYGI 164

  Fly   194 KFSREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIG 258
            .|||.|||..|..:|.|..||||||||||..::..|:.||||||:|||||.||||..|..||.:|
Human   165 DFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVG 229

  Fly   259 DNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMP 323
            ..||.:::.|.:|:|..:                                               
Human   230 HLLKEKYNAAVQVEVVRA----------------------------------------------- 247

  Fly   324 DILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLV 388
                      |::..|.......|                             ..::.|...|||
Human   248 ----------SRLRQPTFLRIKQL-----------------------------RSYQKPMETDLV 273

  Fly   389 YLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEV 453
            |:|.||::||::...|.:||.||.||.||.|.|||..|||||||...:...|.:|.|.|||||.|
Human   274 YIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFV 338

  Fly   454 KCKLCRTKKVIYTC 467
            ||..|..:..::||
Human   339 KCNTCSERTEVFTC 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 140/404 (35%)
WNT7BXP_011528668.1 wnt_Wnt7b 36..353 CDD:381724 140/404 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.