DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and WNT6

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_006513.1 Gene:WNT6 / 7475 HGNCID:12785 Length:365 Species:Homo sapiens


Alignment Length:452 Identity:156/452 - (34%)
Similarity:213/452 - (47%) Gaps:127/452 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GSMWWGIAKVGEPNNITPIMYMDPAIHSTLRRKQRRLV-------RDNPGVLGALVKGANLAISE 92
            |.:||.   ||.|      :.|||   :::.||.|||.       :..|.|:..|.:||.|.:.|
Human    23 GGLWWA---VGSP------LVMDP---TSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRE 75

  Fly    93 CQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCD 157
            ||.|||.||||||:.:     ..||:|:.:..|||:|::|||:|..:|::.:|||.|.:..|.|.
Human    76 CQFQFRFRRWNCSSHS-----KAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQ 135

  Fly   158 YSHQSRSPQAN---------HQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDT-GERGR-NLRE 211
            .......|:.:         ..|||..|...||||||.|::.||.:.||.|:|. .:||| ::|.
Human   136 APRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRA 200

  Fly   212 KMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQVTNS 276
            .:.||||||||..|::..|.||||||:||||.::|||.:|..||.:|..|..||.||:||..||.
Human   201 LVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTND 265

  Fly   277 LRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNM 341
            .:|.                                                            :
Human   266 GKAL------------------------------------------------------------L 270

  Fly   342 PSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGIL 406
            |:..:|                                ||||..||:|...||.||..|.|.|..
Human   271 PAVRTL--------------------------------KPPGRADLLYAADSPDFCAPNRRTGSP 303

  Fly   407 GTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTCL 468
            ||.||.||.::..:.||.|:|||||:|::.|.:.|.|.|.|||||.|:|..||.:|.:..||
Human   304 GTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 145/421 (34%)
WNT6NP_006513.1 wnt 47..364 CDD:278536 141/413 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..164 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D280593at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.