DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and WNT3

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_110380.1 Gene:WNT3 / 7473 HGNCID:12782 Length:355 Species:Homo sapiens


Alignment Length:440 Identity:146/440 - (33%)
Similarity:196/440 - (44%) Gaps:119/440 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MWWGIAKVGEPNNITPIMYMDPAIHSTLRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRR 101
            :||.:|...:..::.....:..:|.. |..||.|..|:...::.::.:|..|.|.|||||||.||
Human    25 IWWSLALGQQYTSLGSQPLLCGSIPG-LVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRR 88

  Fly   102 WNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQ 166
            |||:|.:.|..  :||.::|:..||::|::||.||.|..::.|:|:|||...|.|| ||....|.
Human    89 WNCTTIDDSLA--IFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCD-SHHKGPPG 150

  Fly   167 ANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQ 231
                       ..|:|||||::..||...||||.|..|...:.|..||.|||||||..:...|..
Human   151 -----------EGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEAGRTTILDHMHL 204

  Fly   232 ECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQV---------TNSLRATNALAPVS 287
            :|||||:||||.|||||....:||.|||.||.::|.|:.:.|         ..:|||..:|    
Human   205 KCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYSL---- 265

  Fly   288 PNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQ 352
                                                                             
Human   266 ----------------------------------------------------------------- 265

  Fly   353 RGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETS 417
                                      .|||..:||||.|.||:|||.|...|..||..|.||.||
Human   266 --------------------------FKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVTS 304

  Fly   418 LGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC 467
            .|:|||.|:|||||:........|:|.|.|||||.|.|:.|.....::||
Human   305 HGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTC 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 142/413 (34%)
WNT3NP_110380.1 Wnt_Wnt3_Wnt3a 42..355 CDD:381709 143/423 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40463
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.