DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and wnt3a

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001007186.1 Gene:wnt3a / 60632 ZFINID:ZDB-GENE-001106-1 Length:365 Species:Danio rerio


Alignment Length:447 Identity:149/447 - (33%)
Similarity:199/447 - (44%) Gaps:121/447 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MWWGIAKVGEPN---NITPIMYMD-PAIHSTLRRKQRRLVRDNPGVLGALVKGANLAISECQHQF 97
            :||.:| ||...   ...|||... |.    |..||.|..|:...::.::.:|..:.|.||||||
Zfish    23 IWWSLA-VGHQYTSLGTQPIMCSSIPG----LVPKQLRFCRNYVEIMPSVAEGVKIGIQECQHQF 82

  Fly    98 RNRRWNCSTRNFSRGKNLFGKIVD------------RGCRETSFIYAITSAAVTHSIARACSEGT 150
            |.|||||:|.|....  :||.::|            :..||::|::||.||.|...:.|||:||:
Zfish    83 RGRRWNCTTINDKLA--IFGPVLDKEKERKIGFKQAKATRESAFVHAIASAGVAFXVTRACTEGS 145

  Fly   151 IESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGERGRNLREKMNL 215
            ...|.||  .:.:.|..          ..|:|||||:::.||...||||.|..|...:.|..||.
Zfish   146 ATICGCD--SRRKGPPG----------EGWKWGGCSEDVEFGSMVSREFADARENRPDARSAMNR 198

  Fly   216 HNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRAT 280
            |||||||:.:...|..:|||||:||||.|||||....:||||||.:|.::|.|:           
Zfish   199 HNNEAGRSSITDHMYLKCKCHGLSGSCEVKTCWWSQPDFRVIGDYMKDKYDSAS----------- 252

  Fly   281 NALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPN 345
                                              |.::..|                        
Zfish   253 ----------------------------------EMVVEKH------------------------ 259

  Fly   346 SLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHG 410
                             |:...:...|.|..|.:|||...||||.|.||:|||.|...|..||..
Zfish   260 -----------------RESRGWVETLRPKYPYYKPPTETDLVYYESSPNFCEPNPETGSFGTRD 307

  Fly   411 RQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC 467
            |.||.||.|:|||.|:|||||:........|:|.|.|||||.|.|:.|.....::||
Zfish   308 RTCNLTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECTRVYDVHTC 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 140/416 (34%)
wnt3aNP_001007186.1 WNT1 45..365 CDD:128408 141/424 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.