DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and wnt7aa

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001020711.1 Gene:wnt7aa / 565714 ZFINID:ZDB-GENE-051129-1 Length:349 Species:Danio rerio


Alignment Length:404 Identity:141/404 - (34%)
Similarity:191/404 - (47%) Gaps:99/404 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETS 128
            |..:||.:.:..|..:..:.:||.:.|:|||.||:|.|||||...   .:.:|||.:..|.:|.:
Zfish    44 LAPRQRTICQSRPDAIIVIGEGAQMGINECQFQFKNGRWNCSALG---ERTVFGKELKVGSKEAA 105

  Fly   129 FIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGF 193
            |.|||.:|.|.|:|..||::||:..|.||...|.   ..|.:.|       |:|||||.:|.:|.
Zfish   106 FTYAIIAAGVAHAITAACTQGTLSGCGCDKEKQG---FYNQEEG-------WKWGGCSADIRYGL 160

  Fly   194 KFSREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIG 258
            .||:.|:|..|..:|.|..|||||||.||..::..||.||||||:|||||.||||..|..||.:|
Zfish   161 SFSKVFLDAREIKQNARTLMNLHNNEVGRKILEKNMRLECKCHGVSGSCTTKTCWTTLPKFRQLG 225

  Fly   259 DNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMP 323
            ..||.|::.|..|:            ||                                     
Zfish   226 YILKERYNHAVHVE------------PV------------------------------------- 241

  Fly   324 DILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLV 388
                                         |..||.|....|..:      |::  ::.|...|||
Zfish   242 -----------------------------RASRNKRPAFLKVKK------PYS--YRKPMDTDLV 269

  Fly   389 YLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEV 453
            |:|.||::||.:...|.:||.||.||:|:...:||.||||||||...:...|.:|.|.|.|||.|
Zfish   270 YIEKSPNYCEADPVTGSMGTQGRICNKTAQHTNGCDLMCCGRGYNTHQYSRVWQCNCKFLWCCYV 334

  Fly   454 KCKLCRTKKVIYTC 467
            ||..|..:..:|||
Zfish   335 KCNTCSERTEVYTC 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 141/404 (35%)
wnt7aaNP_001020711.1 wnt 44..349 CDD:278536 141/404 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.