DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and wntD

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:399 Identity:84/399 - (21%)
Similarity:132/399 - (33%) Gaps:147/399 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRG-CRETSFIYAITSAAVTHSIARACS 147
            ||...|:..||..|:.:||||.:::|.: ||  .|..:.. .||..::.||:.||:.|::.:.|:
  Fly    42 KGLKQALDSCQQSFQWQRWNCPSQDFVQ-KN--SKPEENSPNREDVYVAAISMAAIVHTLTKDCA 103

  Fly   148 EGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGERGRNLREK 212
            .|.|..|.|  :..:.:....|:........:..:|..|..||                      
  Fly   104 NGVIAGCGC--TENALNVPCAHEPTKALEQYEKHFGSGSGAIG---------------------- 144

  Fly   213 MNLHNNEAGRAHVQAEMRQECKCH---GMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQVT 274
               ||.....|.:|..:.|||:|.   .:.|.|..:.|...|..|..|..:|...:|.|.:::  
  Fly   145 ---HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLE-- 204

  Fly   275 NSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHP 339
                           .|.||                                       .||...
  Fly   205 ---------------GASSN---------------------------------------LKIMWQ 215

  Fly   340 NMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQG 404
            |:|..:                                         ||:::.||::||::....
  Fly   216 NIPLDS-----------------------------------------LVFMQDSPNYCERDATGL 239

  Fly   405 ILGTHGRQCNETSLGVDGCG-----LMC------CGRGYRRDEVVVVERCACTFHWCCEVKCKLC 458
            ..||.||||::     ||.|     |.|      ||...|...|....||.|...|...::|.:|
  Fly   240 WKGTRGRQCSK-----DGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVC 299

  Fly   459 RTKKVIYTC 467
            ...:..|:|
  Fly   300 VQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 84/399 (21%)
wntDNP_650272.1 wnt 41..308 CDD:302926 83/397 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.