DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and wnt2ba

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_878296.1 Gene:wnt2ba / 359837 ZFINID:ZDB-GENE-030717-2 Length:387 Species:Danio rerio


Alignment Length:489 Identity:152/489 - (31%)
Similarity:222/489 - (45%) Gaps:147/489 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MALCSGGSSLSQVEGKQKSGRG--------RG---------------------SMWWGIAKVGEP 47
            |..|.|....|.....::..||        ||                     |.||.|..:|..
Zfish     1 MPECDGVGCASPARRDRQRARGGFLSRRERRGATQRIYLLFILLLLMFTPSVDSSWWYIGALGAR 65

  Fly    48 ---NNITPIMYMDPAIHSTLRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNF 109
               :||..::           .|||:|.:.:|.::.::.:||...|.|||||||:.||||||  .
Zfish    66 VICDNIPGLV-----------NKQRQLCQRHPDLMQSIGQGAKEWIRECQHQFRHHRWNCST--L 117

  Fly   110 SRGKNLFGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSV 174
            .|...:||:::.|..||.:|:|||:||.|.::|.||||:|.::.|:||...:.|   |:.:.|  
Zfish   118 ERDHTVFGRVMLRSSREAAFVYAISSAGVVYAITRACSQGELKICSCDSQRRGR---ASDEDG-- 177

  Fly   175 AGVRDWEWGGCSDNIGFGFKFSREFVDTGER-GRNLREKMNLHNNEAGRAHVQAEMRQECKCHGM 238
                |::||||||||.:|.||::.|||..|| .::.|..||||||..||..|:..|:.||||||:
Zfish   178 ----DFDWGGCSDNINYGIKFAKAFVDARERMVKDARALMNLHNNRCGRMAVKRFMKTECKCHGV 238

  Fly   239 SGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLII 303
            ||||.::|||:.:.:||..||.|:.:::.|..|.:                    |..|:..::.
Zfish   239 SGSCALRTCWLAMPDFRRTGDYLRKKYNAAVEVMM--------------------NQDGTGFMVA 283

  Fly   304 PQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRY 368
            .:                                                               
Zfish   284 DR--------------------------------------------------------------- 285

  Fly   369 HFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYR 433
                     ::|.....||||:|.||.:|..:...|.|||.||.||::|.|:|||.:|||||||.
Zfish   286 ---------DYKRTTKNDLVYIENSPDYCLMDRSAGSLGTSGRVCNKSSRGMDGCEIMCCGRGYD 341

  Fly   434 RDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC 467
            ...|..:.:|.|.|.|||.|:|:.|.....::||
Zfish   342 TTRVNRMTKCECKFKWCCAVECRDCEETVDVHTC 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 137/405 (34%)
wnt2baNP_878296.1 wnt 74..376 CDD:278536 137/416 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.