DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and Wnt2

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster


Alignment Length:406 Identity:137/406 - (33%)
Similarity:185/406 - (45%) Gaps:100/406 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYA 132
            ||.:.|:.|..|.||.:|..|...|||||||..|||||.   ...:|:|..::....||.::.||
  Fly    40 QRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSE---VWQRNVFAHVIPTASREAAYTYA 101

  Fly   133 ITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRD--WEWGGCSDNIGFGFKF 195
            |.||...:::..||:.|.|.:|.||..|:: :|..       .|..|  |:|||||.::.||.::
  Fly   102 IASAGAAYAVTAACARGNISTCGCDVRHKA-TPTG-------GGTPDEPWKWGGCSADVDFGMRY 158

  Fly   196 SREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDN 260
            :|.|:|..|..|:.|..||||||.|||..|:..:|.:|||||:||||.:||||..|..||::||.
  Fly   159 ARRFMDARELERDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDR 223

  Fly   261 LKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDI 325
            |..::..|..||...                     |..||.:                     :
  Fly   224 LMLKYQKAKTVQAVK---------------------GKRGLRL---------------------V 246

  Fly   326 LLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKP----PGSKD 386
            |....|                  ||     ..|.|                  ||    |...:
  Fly   247 LSRKKH------------------AG-----TARAQ------------------KPVLDWPKRME 270

  Fly   387 LVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCC 451
            |:|||.||::||::|:.|..||.||.|..|..|...|.|:|||||:....:....:|.|.|.|||
  Fly   271 LIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCC 335

  Fly   452 EVKCKLCRTKKVIYTC 467
            ||||..|......:||
  Fly   336 EVKCDECDESYEEFTC 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 137/406 (34%)
Wnt2NP_476810.1 wnt 36..352 CDD:278536 137/406 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D68684at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.