DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and Wnt9b

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001100525.1 Gene:Wnt9b / 303586 RGDID:1309574 Length:359 Species:Rattus norvegicus


Alignment Length:407 Identity:131/407 - (32%)
Similarity:186/407 - (45%) Gaps:114/407 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGK--IVDRGCRE 126
            |.|.|::|.|..||:...|...|:|.:.|||.|||..|||||         |.|:  ::.||.:|
  Rat    62 LSRWQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCS---------LEGRTGLLQRGFKE 117

  Fly   127 TSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGF 191
            |:|:||:::||:||::|||||.|.:|.||||.|....|.||            |:||.|.||:.:
  Rat   118 TAFLYAVSAAALTHALARACSAGRMERCTCDDSPGLESRQA------------WQWGVCGDNLKY 170

  Fly   192 GFKFSREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRV 256
            ..||...|:......::||.:.:.||...|...|::.:|..|||||:||||.|:|||.:|:.||.
  Rat   171 STKFLSNFLGPKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRE 235

  Fly   257 IGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDH 321
            .|..||.|:|.|.:|                 ::|.:.::|...|.:|..               
  Rat   236 TGQVLKLRYDTAVKV-----------------SSATNEALGRLELWVPAK--------------- 268

  Fly   322 MPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKD 386
                             |..|:....|:                                  ..|
  Rat   269 -----------------PGGPAKGLAPR----------------------------------PVD 282

  Fly   387 LVYLEPSPSFCEKNLRQGILGTHGRQCN-ETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWC 450
            |||:|.|||||..:....  ||.||.|: :||     |..:||||||.....:|...|.|...||
  Rat   283 LVYMEDSPSFCRPSKYSP--GTAGRVCSRDTS-----CSSLCCGRGYDTQSRMVAFSCHCQVQWC 340

  Fly   451 CEVKCKLCRTKKVIYTC 467
            |.|:|:.|..::::|||
  Rat   341 CYVECQQCAQQELVYTC 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 131/407 (32%)
Wnt9bNP_001100525.1 wnt 62..358 CDD:278536 131/407 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.