DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and wnt11

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_571151.1 Gene:wnt11 / 30283 ZFINID:ZDB-GENE-980526-249 Length:352 Species:Danio rerio


Alignment Length:441 Identity:130/441 - (29%)
Similarity:195/441 - (44%) Gaps:121/441 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GSMWWGIAKVGEPNNITPIMYMDPAIHSTLRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRN 99
            |..|..:::..:..|.|......|.:.|:    |.:|.|.|..::..:::.|......||..|.:
Zfish    24 GIRWLALSQTAQHINKTQHCKTLPGLVSS----QAQLCRSNLELMQTIIQAAREVKKVCQKTFTD 84

  Fly   100 RRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRS 164
            .|||||:.:..:    |...::||.||::|:||:::||::|:|||||:.|.:..|:|        
Zfish    85 MRWNCSSIDGPK----FLPDLERGTRESAFVYALSAAAISHTIARACTSGDLRLCSC-------- 137

  Fly   165 PQANHQAGSVAG---VRDWEWGGCSDNIGFGFKFSREFVDT-----GERGRNLREKMNLHNNEAG 221
                   |.:.|   ...:.||||:|||.:|.....:|.|.     .:.|.:..:.|:|||:|.|
Zfish   138 -------GPIPGEIPEPGYRWGGCADNIHYGLLMGSKFSDAPMKMKKKSGSHANKLMHLHNSEVG 195

  Fly   222 RAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRATNALAPV 286
            |..::..:..:|||||:||||:::|||..|.:.:.|..:||.::..||:|               
Zfish   196 RQALRDALVMKCKCHGVSGSCSIRTCWRGLLDLKDIAIDLKTKYLSATKV--------------- 245

  Fly   287 SPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAG 351
                                                             :|.|            
Zfish   246 -------------------------------------------------VHRP------------ 249

  Fly   352 QRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNET 416
                 .|.|:         ||.|.:.:.:|....:||||:.||.:|.||.:.|..||..||||:|
Zfish   250 -----MGTRK---------QLVPKDIDIRPVRENELVYLQSSPDYCMKNDKLGSFGTQDRQCNKT 300

  Fly   417 SLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC 467
            |.|.|.|.||||||||......|||||.|.:||||.|.||.|......|.|
Zfish   301 SSGSDSCDLMCCGRGYNPYTERVVERCHCKYHWCCYVTCKKCDKTVEKYVC 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 124/412 (30%)
wnt11NP_571151.1 wnt 49..352 CDD:278536 125/416 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.