DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and Wnt8a

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001099625.1 Gene:Wnt8a / 291678 RGDID:1306312 Length:359 Species:Rattus norvegicus


Alignment Length:397 Identity:132/397 - (33%)
Similarity:178/397 - (44%) Gaps:120/397 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 GANLAISECQHQFRNRRWNC-------STRNFSRGKNLFGKIVDRGCRETSFIYAITSAAVTHSI 142
            ||.:.:.||:.||...||||       ||....||          ..||||||:||.||||.:::
  Rat    50 GAQMGMEECKFQFAWERWNCPEHAFQFSTHTRPRG----------ATRETSFIHAIRSAAVMYAV 104

  Fly   143 ARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGERGR 207
            .:.||.|.:|:|.||.|:..:           ||...|.|||||||:.||.|.||.|||:.|:|:
  Rat   105 TKNCSMGDLETCGCDESNNGK-----------AGGHGWIWGGCSDNVEFGEKISRLFVDSLEKGK 158

  Fly   208 NLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQ 272
            :.|..||||||.|||..|:|.|::.|||||:||||:::|||::||:||.:|:.|||::|.|.:: 
  Rat   159 DARALMNLHNNRAGRLAVRASMKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKI- 222

  Fly   273 VTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPISKIH 337
                                                   |.::|.|                   
  Rat   223 ---------------------------------------ETDKRQL------------------- 229

  Fly   338 HPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLR 402
                       :||.|.      :||......|         .|....:|::||.||.:|.:|..
  Rat   230 -----------RAGNRA------EGRWAPIEAF---------LPSAEAELIFLEGSPDYCNRNAS 268

  Fly   403 QGILGTHGRQCNETSLGVD-----GCGLMC--CGRGYRRDEVVVVERCACTFHWCCEVKCKLCRT 460
            .||.||.||:|.:.:....     .||.:|  ||..........|..|.|.|.|||.|||..||.
  Rat   269 LGIYGTEGRECLQNARSASRWEQRSCGRLCTECGLQVEERRTEAVSSCDCNFQWCCTVKCGQCRR 333

  Fly   461 KKVIYTC 467
            ....|.|
  Rat   334 VVNRYYC 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 132/397 (33%)
Wnt8aNP_001099625.1 WNT1 25..340 CDD:128408 131/395 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.