DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and Wnt9a

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001099253.2 Gene:Wnt9a / 287357 RGDID:1305018 Length:365 Species:Rattus norvegicus


Alignment Length:432 Identity:137/432 - (31%)
Similarity:200/432 - (46%) Gaps:115/432 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EPNNITPIMYMDPAIHST---------LRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRR 101
            ||..|.|:.....|....         |.|||||:.|.:|||...||:..:::..|||:|||..|
  Rat    37 EPLTILPLTLETEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETLVEAVSMSALECQYQFRFER 101

  Fly   102 WNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQ 166
            |||:.....|     ..::.||.:||:|:|||:||.:||::|:|||.|.:|.||||.:....:.:
  Rat   102 WNCTLEGRYR-----ASLLKRGFKETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENRE 161

  Fly   167 ANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGER-GRNLREKMNLHNNEAGRAHVQAEMR 230
            |            |:||||.||:.:..||.:||:  |.| .::||.:::.|||..|...::|.:.
  Rat   162 A------------WQWGGCGDNLKYSSKFVKEFL--GRRSSKDLRARVDFHNNLVGVKVIKAGVE 212

  Fly   231 QECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNS 295
            ..|||||:||||||:|||.:||.|..:|.:||.:::.:.:|..|     ||            .:
  Rat   213 TTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETSLKVGST-----TN------------EA 260

  Fly   296 VGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRR 360
            .|..|.|.|..|..                                        :|..||     
  Rat   261 TGEAGAISPPRGRA----------------------------------------SGSGGG----- 280

  Fly   361 QGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGL 425
                           :|..:.|   :||:|:.|||||...  :...||.||:|:...    .|..
  Rat   281 ---------------DPLPRTP---ELVHLDDSPSFCLAG--RFSPGTAGRRCHREK----NCES 321

  Fly   426 MCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC 467
            :|||||:.....||...|.|...|||.|:|:.|..::.:|||
  Rat   322 ICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 132/405 (33%)
Wnt9aNP_001099253.2 Wnt 64..364 CDD:393294 132/405 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.