DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and Wnt6

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_033552.2 Gene:Wnt6 / 22420 MGIID:98960 Length:364 Species:Mus musculus


Alignment Length:478 Identity:158/478 - (33%)
Similarity:221/478 - (46%) Gaps:142/478 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ICLMALCSGGSSLSQVEGKQKSGRGRGSMWWGIAKVGEPNNITPIMYMDPAIHSTLRRKQRRLV- 72
            :.|:.||.     :.|:|          :||.   ||.|      :.|||   :::.||.|||. 
Mouse    11 LLLLLLCP-----AHVDG----------LWWA---VGSP------LVMDP---TSICRKARRLAG 48

  Fly    73 ------RDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIY 131
                  :..|.|:..|.:||.|.:.|||.|||.||||||:.:     ..||:::.:..|||:|::
Mouse    49 RQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHS-----KAFGRVLQQDIRETAFVF 108

  Fly   132 AITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGS-----VAGVRD----WEWGGCSD 187
            |||:|..:|::.:|||.|.:..|.|........|:.:...|:     ..|..|    ||||||.|
Mouse   109 AITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSPDASAAWEWGGCGD 173

  Fly   188 NIGFGFKFSREFVDT-GERGR-NLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMR 250
            ::.||.:.||.|:|. .:||| ::|..:.||||||||..|::..|.||||||:||||.::|||.:
Mouse   174 DVDFGDEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQK 238

  Fly   251 LANFRVIGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEE 315
            |..||.:|..|..||.||:||..||..:|.                                   
Mouse   239 LPPFREVGARLLERFHGASRVMGTNDGKAL----------------------------------- 268

  Fly   316 RMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHK 380
                                     :|:..:|                                |
Mouse   269 -------------------------LPAVRTL--------------------------------K 276

  Fly   381 PPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCAC 445
            |||..||:|...||.||..|.|.|..||.||.||.::..:.||.|:|||||:|::.|.:.|.|.|
Mouse   277 PPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLC 341

  Fly   446 TFHWCCEVKCKLCRTKKVIYTCL 468
            .|||||.|:|..||.:|.:..||
Mouse   342 RFHWCCVVQCHRCRVRKELSLCL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 143/421 (34%)
Wnt6NP_033552.2 Wnt_Wnt6 34..364 CDD:381712 146/429 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..162 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D280593at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.