DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and Wnt10b

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_035848.1 Gene:Wnt10b / 22410 MGIID:108061 Length:389 Species:Mus musculus


Alignment Length:458 Identity:142/458 - (31%)
Similarity:198/458 - (43%) Gaps:132/458 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GIAKVGEP----NNITPIMYMDPAIHSTLRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNR 100
            |:...|||    |.:...:       |.|.::|..|...:|.|..:.::|.::|:.|||||.|::
Mouse    33 GLKLPGEPPLTANTVCLTL-------SGLSKRQLGLCLRSPDVTASALQGLHIAVHECQHQLRDQ 90

  Fly   101 RWNCSTRNFSRGKNL--FGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDY---SH 160
            |||||.  ...|..|  ...|:.||.||::|.:::.:|.|.|::|.|||.|.:.||.|.:   ..
Mouse    91 RWNCSA--LEGGGRLPHHSAILKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKGSGE 153

  Fly   161 QSR------------------SPQANHQAGSV--AGVRD-WEWGGCSDNIGFGFKFSREFVDTGE 204
            |.|                  ..|.:...|||  .|.:| ||||||:.::.||.||||:|:|:.|
Mouse   154 QDRLRAKLLQLQALSRGKTFPISQPSPVPGSVPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSRE 218

  Fly   205 RGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGAT 269
            ..|:::.:|.:|||..||..|...::::|||||.||||..||||.....||.||..|:.|...|.
Mouse   219 APRDIQARMRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAIGAALRERLSRAI 283

  Fly   270 RVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPIS 334
            .:...|  |.:.|..|                                                 
Mouse   284 FIDTHN--RNSGAFQP------------------------------------------------- 297

  Fly   335 KIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEK 399
                                                :|.|...      |.:|||.|.||.|||:
Mouse   298 ------------------------------------RLRPRRL------SGELVYFEKSPDFCER 320

  Fly   400 NLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVI 464
            :...|..||.||.||:||..:||||.:|||||:.......||||.|.|||||.|.|..|:..:.:
Mouse   321 DPTLGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTRVERCHCRFHWCCYVLCDECKVTEWV 385

  Fly   465 YTC 467
            ..|
Mouse   386 NVC 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 136/430 (32%)
Wnt10bNP_035848.1 Wnt_Wnt10b 45..389 CDD:381730 138/446 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.