DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and wnt7c

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_031747904.1 Gene:wnt7c / 100490426 XenbaseID:XB-GENE-5835754 Length:350 Species:Xenopus tropicalis


Alignment Length:406 Identity:139/406 - (34%)
Similarity:190/406 - (46%) Gaps:103/406 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGK-NLFGKIVDRGCRET 127
            |..:||.:....|..:.|:..||.|...|||:||::.||||:    |.|: ::||:.:..|.|||
 Frog    45 LSPRQRTICEARPDAMIAVGTGARLGTEECQYQFQHSRWNCT----SLGEPSVFGQELKVGSRET 105

  Fly   128 SFIYAITSAAVTHSIARACSEGTIESCTCDYSHQS-RSPQANHQAGSVAGVRDWEWGGCSDNIGF 191
            :|.|||.||.:.|||..|||:|.:..|:||..... :.|:           :.|.|||||.::.:
 Frog   106 AFYYAILSAGIAHSITNACSQGNLTYCSCDREKNGYQDPE-----------KGWRWGGCSADVKY 159

  Fly   192 GFKFSREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRV 256
            |.:|||||||..|..||.|..||||||..||..::..:..||||||:|||||:||||:.|.:||.
 Frog   160 GIRFSREFVDAREVKRNARTLMNLHNNMVGRKLLEKNIHLECKCHGVSGSCTLKTCWLTLPHFRE 224

  Fly   257 IGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDH 321
            :|..:..::..|..|:   ::|....|.|..                                  
 Frog   225 VGYAIMDKYKQAVMVE---AVRGRRQLLPTF---------------------------------- 252

  Fly   322 MPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKD 386
               :.|:|....||                                              |...|
 Frog   253 ---LKLKNPQSYSK----------------------------------------------PAETD 268

  Fly   387 LVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCC 451
            |||::.|||||||:...|.:||:||.||.||...|.|.|:||||||:..:.....:|.|.|||||
 Frog   269 LVYVDRSPSFCEKDNATGSIGTYGRFCNRTSTQADSCELLCCGRGYKTFQYTHTWQCHCKFHWCC 333

  Fly   452 EVKCKLCRTKKVIYTC 467
            .|.|..|..:...|||
 Frog   334 HVTCSTCSERTQAYTC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 139/406 (34%)
wnt7cXP_031747904.1 Wnt_Wnt7 38..350 CDD:381713 139/406 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.