DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and wnt3a

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_002939354.2 Gene:wnt3a / 100488632 XenbaseID:XB-GENE-1217288 Length:352 Species:Xenopus tropicalis


Alignment Length:463 Identity:150/463 - (32%)
Similarity:204/463 - (44%) Gaps:117/463 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YIFVICLMALCSGGSSLSQVEGKQKSGRGRGSMWWGIAKVGEPNNITPIMYMDPAIHSTLRRKQR 69
            |..:||         .|.||....       .:||.:| ||:..:......:.......|..||.
 Frog     6 YFLIIC---------GLHQVAATY-------PIWWSLA-VGQQYSTLGTQPIPCGTIPGLVAKQM 53

  Fly    70 RLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAIT 134
            |..|:...::.::.:|..:.|.|||||||.|||||:|.|.:..  :||.::|:..||::|::||.
 Frog    54 RFCRNYMEIMPSVAEGVKIGIQECQHQFRGRRWNCTTVNDNLA--IFGPVLDKATRESAFVHAIA 116

  Fly   135 SAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREF 199
            ||.|..::.|:|:||:...|.|| ||....|.           ..|:|||||:::.||...||||
 Frog   117 SAGVAFAVTRSCAEGSATICGCD-SHHKGPPG-----------EGWKWGGCSEDMDFGSMVSREF 169

  Fly   200 VDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKAR 264
            .|..|...:.|..||.|||||||..:......:|||||:||||.|||||....:||||||.||.:
 Frog   170 ADARENRPDARSAMNRHNNEAGRTSILDHRHLKCKCHGLSGSCEVKTCWWSQPDFRVIGDYLKDK 234

  Fly   265 FDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLEN 329
            :|.|:                                             |.::..|        
 Frog   235 YDSAS---------------------------------------------EMVVEKH-------- 246

  Fly   330 SHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSP 394
                                             |:...:...|.|.....|||..:||:|.|.||
 Frog   247 ---------------------------------RESRGWVETLRPKYTFFKPPTERDLIYYESSP 278

  Fly   395 SFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCR 459
            :|||.|...|..||..|.||.||.|:|||.|:|||||:........|:|.|.|||||.|.|:.|.
 Frog   279 NFCEPNPETGSFGTRDRVCNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECI 343

  Fly   460 TKKVIYTC 467
            ....::||
 Frog   344 RVYDVHTC 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 139/404 (34%)
wnt3aXP_002939354.2 Wnt_Wnt3_Wnt3a 39..352 CDD:381709 139/413 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47640
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.