DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and wnt7b

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001120105.1 Gene:wnt7b / 100145124 XenbaseID:XB-GENE-481936 Length:282 Species:Xenopus tropicalis


Alignment Length:382 Identity:139/382 - (36%)
Similarity:182/382 - (47%) Gaps:103/382 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIE 152
            :.|:|||:|||..|||||...   .:.:||:.:..|.||.:|.||||:|.|.|::..|||:|.:.
 Frog     1 MGINECQYQFRYGRWNCSALG---ERTVFGQELRVGSREAAFTYAITAAGVAHAVTSACSQGNLS 62

  Fly   153 SCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGERGRNLREKMNLHN 217
            :|.||...|.   ..|.:.|       |:|||||.:|.:|..|||:|||..|..:|.|..|||||
 Frog    63 NCGCDREKQG---YYNQEEG-------WKWGGCSADIKYGIDFSRKFVDAREIKKNARRLMNLHN 117

  Fly   218 NEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGATRVQV--TNSLRAT 280
            |||||..::.:|:.||||||:|||||.||||..|..||.||..||.:::.|..|:|  .|.||  
 Frog   118 NEAGRKVLEEKMKLECKCHGVSGSCTTKTCWNTLPKFREIGFVLKEKYNDAVHVEVVRANRLR-- 180

  Fly   281 NALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPN 345
                                                     .|..|     .|.|:.        
 Frog   181 -----------------------------------------QPTFL-----KIKKVR-------- 191

  Fly   346 SLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHG 410
                                            .::.|...||||:|.||::||::...|.:||.|
 Frog   192 --------------------------------SYQKPMETDLVYIERSPNYCEEDSATGSVGTQG 224

  Fly   411 RQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC 467
            |.||.||...|||.||||||||...:...|.:|.|.|||||.|||..|..:..::||
 Frog   225 RLCNRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 139/382 (36%)
wnt7bNP_001120105.1 Wnt 1..282 CDD:393294 139/382 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.