DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and wnt9b

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001096553.1 Gene:wnt9b / 100125200 XenbaseID:XB-GENE-866787 Length:357 Species:Xenopus tropicalis


Alignment Length:423 Identity:135/423 - (31%)
Similarity:192/423 - (45%) Gaps:126/423 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PAIHST-------------LRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNF 109
            |.|.||             |.|:||||.|..||:..||.:...|.:.|||.|.|:.|||||.:. 
 Frog    46 PVISSTHSRPHLKQCDLLPLTRRQRRLCRKEPGLAEALREAVRLGVVECQFQLRSERWNCSLQE- 109

  Fly   110 SRGKNLFGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSV 174
                  .|.::.||.:||:|:|||::|::|||:|:|||.|.:|.||||.|....|.||       
 Frog   110 ------RGNLLKRGFKETAFMYAISAASLTHSLAKACSGGRMERCTCDDSQGLESQQA------- 161

  Fly   175 AGVRDWEWGGCSDNIGFGFKFSREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMS 239
                 |:||.|.||:....:|.:.|:...:.||:.|.||:|||:.||...|::.::..|||||:|
 Frog   162 -----WQWGVCGDNLRHSTRFLQNFLRQKKGGRDARAKMDLHNSNAGIKAVKSGLKTTCKCHGVS 221

  Fly   240 GSCTVKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIP 304
            |||.|:|||.:|:.|...|..|||:::.|.::                 :.|.:.:||.      
 Frog   222 GSCAVRTCWKQLSPFHETGALLKAKYENAIKI-----------------HGASNEAVGG------ 263

  Fly   305 QSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYH 369
                                             |.::                |...|.:|.|  
 Frog   264 ---------------------------------HESL----------------GHTFGGRHAR-- 277

  Fly   370 FQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRR 434
                          |.|.:|||.||:||..:  :...||.||.|    |..:.|..:||||||..
 Frog   278 --------------STDFLYLEESPNFCRPS--RFSPGTAGRTC----LRENTCDSLCCGRGYNI 322

  Fly   435 DEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC 467
            ...:|...|.|..||||.|:|:.|..::..|||
 Frog   323 QTRMVTFSCHCQVHWCCHVECQKCVQQQETYTC 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 131/404 (32%)
wnt9bNP_001096553.1 Wnt_Wnt9b 65..356 CDD:381728 131/404 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.