DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt4

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_445854.1 Gene:Wnt4 / 84426 RGDID:621348 Length:351 Species:Rattus norvegicus


Alignment Length:312 Identity:112/312 - (35%)
Similarity:165/312 - (52%) Gaps:30/312 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 RRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLY----KETAFVH 307
            :||...|::...:..::....:||...|:.|||..|||||  |.....:|.|:.    :|.|||:
  Rat    51 QRQVQMCKRNLEVMDSVRHGAQLAIEECQYQFRNRRWNCS--TLDSLPVFGKVVTQGTREAAFVY 113

  Fly   308 ALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDLR-GGDG 371
            |:::|.:..::.|||:.|.:.||.|....|....|.|||.||:||:.:|...::||:|:| ...|
  Rat   114 AISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKG 178

  Fly   372 DEVSEILR--HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIR 434
            ...|..|.  |::|.|.:|:.:.|..:||||||||||.:||||:.:..|......|::|::.|..
  Rat   179 ASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATE 243

  Fly   435 KAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAV--------TKDRQCLHP-- 489
            ..|     |:|.|||...|:..:.||...:  .|.|||.||.:|..        |:.|.|...  
  Rat   244 VEP-----RRVGSSRALVPRNAQFKPHTDE--DLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTSK 301

  Fly   490 --DNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
              |.|..||||||:.|..|:..|:|.|||:  .||.:.|..||||...:.|:
  Rat   302 AIDGCELLCCGRGFHTAHVELAERCGCRFH--WCCFVKCRQCQRLVEMHTCR 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 111/310 (36%)
Wnt4NP_445854.1 wnt 49..351 CDD:278536 112/312 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.