DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and WNT10A

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_079492.2 Gene:WNT10A / 80326 HGNCID:13829 Length:417 Species:Homo sapiens


Alignment Length:364 Identity:111/364 - (30%)
Similarity:168/364 - (46%) Gaps:71/364 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNC-SIETRGK----RNIFKK 298
            |..:|. :|||...|.:...:..:..:..::|...|:.|||..|||| |:|||.|    ..||.:
Human    61 CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYESPIFSR 125

  Fly   299 LYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNRE----------------------- 340
            .::|:||.:|:.||.:.|:::.|||.|::..|.|...:...|                       
Human   126 GFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLSH 190

  Fly   341 --------------AQD-FQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILRHDSEVGIEAVS 390
                          .|| ::||||:.::..|:|.::.|||.|....|..:.:..|::.||.:||.
Human   191 GVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSREPHRDIHARMRLHNNRVGRQAVM 255

  Fly   391 SQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPK- 454
            ..|..||||||.||||.:||||:...:|.....|||.:::.|....|:.|:..|:.......|. 
Human   256 ENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLIRPHNRNGGQLEPGPAGAPSP 320

  Fly   455 -------QRRKKPQQSQYTTLYYLETSPSYC--------AVTKDRQC----LHPDNCGTLCCGRG 500
                   :||..|     ..|.|.|.||.:|        |.|..|.|    ...|.||::|||||
Human   321 APGAPGPRRRASP-----ADLVYFEKSPDFCEREPRLDSAGTVGRLCNKSSAGSDGCGSMCCGRG 380

  Fly   501 YTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
            :......:.|:|.|||:  .||.::|:.|:..|....||
Human   381 HNILRQTRSERCHCRFH--WCCFVVCEECRITEWVSVCK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 107/355 (30%)
WNT10ANP_079492.2 Wnt 58..417 CDD:393294 109/362 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..331 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.