DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wnt16

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001093516.1 Gene:wnt16 / 791563 ZFINID:ZDB-GENE-040426-2330 Length:356 Species:Danio rerio


Alignment Length:345 Identity:124/345 - (35%)
Similarity:183/345 - (53%) Gaps:51/345 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 SQG--------QVGGP----CRYMPATRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWN 284
            |||        .||.|    |.::|.:.:|...|.::..|..::.|..||..|.|:.|||::|||
Zfish    26 SQGSWMWLGITSVGVPEKLGCAHLPLSHKQKELCARKPHLLPSVKEGARLGITECQTQFRHERWN 90

  Fly   285 CSIETRGKRNIFKKLY------KETAFVHALTAAAMTHSIARACAEGRMTKCSCGPK--KHNREA 341
            ||  ||...|:|.  |      |||||:||:.||.:.|::.|:|:.|.||:|||...  ......
Zfish    91 CS--TRRDPNVFG--YELTSGTKETAFIHAVMAAGLVHAVTRSCSAGNMTECSCDTSLLGSGSPT 151

  Fly   342 QDFQWGGCNDNLKHGKRVTRSFLDLRGGD----GDEVSEILR-HDSEVGIEAVSSQMMDKCKCHG 401
            :.:.||||:|::..|...:|.|:|....:    |:|...|:: |:||.|.:||:..|:..|:|||
Zfish   152 EGWHWGGCSDDIAFGTSFSRRFIDSAAKNTSTRGEEALLIMKQHNSEAGRQAVAKTMLTDCRCHG 216

  Fly   402 VSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYT 466
            |||||::||||:.||.|......|:.:|..::...  .||.|:|    .:|.|::|..|....  
Zfish   217 VSGSCAVKTCWRTMAAFERVGAYLKDRYETSVHVV--DRSKRKV----RRKDKEQRHVPITKD-- 273

  Fly   467 TLYYLETSPSYC--------AVTKDRQC----LHPDNCGTLCCGRGYTTQVVKQVEKCRCRFNNG 519
            .|.:...||:||        ..|:.|:|    ..||.|..|||||||.|.||:.||:|.|:|  .
Zfish   274 ELIFFNKSPNYCLEDRRLGVTGTRGRKCNRTSAGPDGCNLLCCGRGYNTHVVRHVERCECKF--V 336

  Fly   520 RCCQLICDYCQRLENKYFCK 539
            .||.:.|..|:.:.:.:.||
Zfish   337 WCCYVRCRRCETMNDMHTCK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 114/317 (36%)
wnt16NP_001093516.1 wnt 51..356 CDD:278536 114/318 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593768
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.