DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wnt10b

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001072771.1 Gene:wnt10b / 780228 XenbaseID:XB-GENE-482664 Length:388 Species:Xenopus tropicalis


Alignment Length:380 Identity:114/380 - (30%)
Similarity:175/380 - (46%) Gaps:80/380 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 LYNEHFISEHTVMAVFTSQGQVGGPCRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQF 278
            |.|:..::.:||             |..:|. ::||...|.:...:..:..:..::|...|:.|.
 Frog    34 LPNDPILTPNTV-------------CLTLPGLSKRQMGLCVRNPDVTASALQGIQIAIHECQHQL 85

  Fly   279 RYDRWNCS-IETRGK----RNIFKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHN 338
            :..||||| :||.||    ..|.|:.::|:||..:|.||.:.||:|.||:.|::..|.|..|:..
 Frog    86 KGQRWNCSTLETMGKMPHDSAILKRGFRESAFAFSLLAAGVMHSVATACSLGKLQGCGCEWKRRG 150

  Fly   339 RE------------------------------------AQD-FQWGGCNDNLKHGKRVTRSFLDL 366
            .|                                    .|| ::||||...|:.|::.:|.|||.
 Frog   151 TEEKIRLKLNQLQLQALSKVKGLPRDLTPLLRETPEPSPQDTWEWGGCKHELEFGEKFSRDFLDS 215

  Fly   367 RGGDGDEVSEILRHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNE 431
            |....|..:.:..|::.||.:||:..|..:|||||.||||..||||....||.|..||:|.|...
 Frog   216 RESPRDIHARMRIHNNRVGRQAVTENMKRRCKCHGTSGSCQFKTCWHVTPDFRAVGTLMRDKLQR 280

  Fly   432 AIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAV--------TKDRQC-- 486
            |:  ..|.|:    .:|....|:..:|:..:.    |.|.|.||.:|..        |:.|.|  
 Frog   281 AV--FVNSRN----KNSGAFHPRLNKKRLAKE----LVYFEKSPDFCEKDPRVDSPGTQGRVCNK 335

  Fly   487 --LHPDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
              ...|||.:||||||:...:..:.|:|.|||:  .||.::|:.|:..:....||
 Frog   336 TSQQMDNCASLCCGRGHNILMQTRRERCNCRFH--WCCYVMCEECRVTQLVNVCK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 106/346 (31%)
wnt10bNP_001072771.1 wnt 52..388 CDD:278536 106/347 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.