DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and WNT9B

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_011523480.1 Gene:WNT9B / 7484 HGNCID:12779 Length:363 Species:Homo sapiens


Alignment Length:362 Identity:126/362 - (34%)
Similarity:189/362 - (52%) Gaps:39/362 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GSNTNNMDMQQGLYNEHFISEHTVMAVFTSQGQVGGP---------CRYMPATRRQNHQCRKETG 258
            |.|.:...:...|.....::...|:..|...|....|         |..:..:|||...||:|.|
Human    15 GLNASPGSLTSPLRRIRSLTGREVLTPFPGLGTAAAPAQGGAHLKQCDLLKLSRRQKQLCRREPG 79

  Fly   259 LPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLYKETAFVHALTAAAMTHSIARACA 323
            |..||.:|..|....|:.|||::|||||:|  |:..:.|:.:|||||::|:::||:||::||||:
Human    80 LAETLRDAAHLGLLECQFQFRHERWNCSLE--GRMGLLKRGFKETAFLYAVSSAALTHTLARACS 142

  Fly   324 EGRMTKCSCGPKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILRHDSEVGIEA 388
            .|||.:|:|.........|.:|||.|.||||:..:...:||..:.|:.|..:....|::.|||:|
Human   143 AGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADAHNTHVGIKA 207

  Fly   389 VSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIR--KAPNQ--------RSMR 443
            |.|.:...||||||||||:::||||:::.|..|..:|:.:|:.|::  .|.|:        ...|
Human   208 VKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDSAVKVSSATNEALGRLELWAPAR 272

  Fly   444 QVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAVTK------DRQCLHPDNCGTLCCGRGYT 502
            |.|.::...|:.          ..|.|:|.|||:|..:|      .|.|....:|.:|||||||.
Human   273 QGSLTKGLAPRS----------GDLVYMEDSPSFCRPSKYSPGTAGRVCSREASCSSLCCGRGYD 327

  Fly   503 TQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
            ||.......|.|:..  .||.:.|..|.:.|..|.||
Human   328 TQSRLVAFSCHCQVQ--WCCYVECQQCVQEELVYTCK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 116/308 (38%)
WNT9BXP_011523480.1 wnt 66..362 CDD:278536 116/309 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 226 1.000 Domainoid score I2521
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I3468
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003784
OrthoInspector 1 1.000 - - oto90845
orthoMCL 1 0.900 - - OOG6_111860
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4229
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.