DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and WNT9A

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_003386.1 Gene:WNT9A / 7483 HGNCID:12778 Length:365 Species:Homo sapiens


Alignment Length:325 Identity:114/325 - (35%)
Similarity:184/325 - (56%) Gaps:44/325 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPATRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLYKETA 304
            |..:...|:|...||::.|:..||.||..::...|:.|||::||||::|.|.:.::.|:.:||||
Human    59 CDRLKLERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFKETA 123

  Fly   305 FVHALTAAAMTHSIARACAEGRMTKCSC--GPKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDLR 367
            |::|:::|.:||::|:||:.|||.:|:|  .|...||||  :|||||.||||:..:..:.||   
Human   124 FLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREA--WQWGGCGDNLKYSSKFVKEFL--- 183

  Fly   368 GGDGDEVSEILR-----HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQ 427
               |...|:.||     |::.||::.:.:.:...||||||||||:::|||:::|.|:.....|:.
Human   184 ---GRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKH 245

  Fly   428 KYNEAIRKAPNQRSMRQVSSSRMKKPKQRR----------KKPQQSQYTTLYYLETSPSYCAV-- 480
            ||..|: |..:..:.....:..:..|:.|.          :.|:      |.:|:.|||:|..  
Human   246 KYETAL-KVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPE------LVHLDDSPSFCLAGR 303

  Fly   481 ----TKDRQCLHPDNCGTLCCGRGYTTQ--VVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
                |..|:|....||.::|||||:.||  ||.:..:|:.|:    ||.:.|..|.:.|..|.||
Human   304 FSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRW----CCYVECRQCTQREEVYTCK 364

  Fly   540  539
            Human   365  364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 111/317 (35%)
WNT9ANP_003386.1 Wnt 64..364 CDD:393294 111/318 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..287 2/26 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 226 1.000 Domainoid score I2521
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I3468
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4229
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.