DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and WNT2B

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_078613.1 Gene:WNT2B / 7482 HGNCID:12781 Length:391 Species:Homo sapiens


Alignment Length:321 Identity:102/321 - (31%)
Similarity:170/321 - (52%) Gaps:33/321 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLY--- 300
            |..:|. ..||...|::...:..::.|..|.....|:.|||:.||||:...| ...:|.::.   
Human    72 CDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDR-DHTVFGRVMLRS 135

  Fly   301 -KETAFVHALTAAAMTHSIARACAEGRMTKCSCGP---KKHNREAQDFQWGGCNDNLKHGKRVTR 361
             :|.|||:|:::|.:.|:|.|||::|.::.|||.|   .:|:.:..||.||||:||:.:|.|..:
Human   136 SREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAK 200

  Fly   362 SFLDLRGGDGDEVSEILR-HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLL 425
            :|:|.:.....:...::. |::..|..||...:..:||||||||||:::|||:.::||..|...|
Human   201 AFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYL 265

  Fly   426 RQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAV--------TK 482
            |::|:.|::....|......::         |:..:::..|.|.|.:.||.||.:        |.
Human   266 RRRYDGAVQVMATQDGANFTAA---------RQGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTA 321

  Fly   483 DRQCLH----PDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
            .|.|..    .|.|..:||||||.|..|.:|.:|.|:|:  .||.:.|..|:...:.:.||
Human   322 GRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFH--WCCAVRCKECRNTVDVHTCK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 98/312 (31%)
WNT2BNP_078613.1 wnt 74..380 CDD:306592 99/317 (31%)
WNT-core domain 107..379 93/283 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.