DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and WNT11

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_011543540.1 Gene:WNT11 / 7481 HGNCID:12776 Length:364 Species:Homo sapiens


Alignment Length:323 Identity:109/323 - (33%)
Similarity:158/323 - (48%) Gaps:53/323 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 CRKETGLPGTLSEARRLATTHCEEQFRYDRWNCS--------------------IETRGKRNIFK 297
            ||....|..|:..|.|.....|...|...|||||                    :...|.|    
Human    59 CRSNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERASADLPLPPSGTR---- 119

  Fly   298 KLYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQDFQWGGCNDNLKHGKRVTRS 362
                |:|||:||:|||::|:|||||..|.:..|||||..........:||||.|||.:|..:...
Human   120 ----ESAFVYALSAAAISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAK 180

  Fly   363 FLDLR---GGDGDEVSEILR-HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATAT 423
            |.|..   ...|.:.::::| |:||||.:|:.:.:..||||||||||||::||||.:.:....|.
Human   181 FSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAA 245

  Fly   424 LLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAV-------- 480
            .|:.:|..|.:..     .|.:.:.:...||....:|.:.  :.|.||::||.:|..        
Human   246 DLKTRYLSATKVV-----HRPMGTRKHLVPKDLDIRPVKD--SELVYLQSSPDFCMKNEKVGSHG 303

  Fly   481 TKDRQCLH----PDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
            |:||||..    .|:|..:||||||.....:.||:|.|:::  .||.:.|..|:|...:|.||
Human   304 TQDRQCNKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYH--WCCYVTCRRCERTVERYVCK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 107/321 (33%)
WNT11XP_011543540.1 wnt 47..364 CDD:302926 107/321 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.