DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and WNT8B

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_003384.2 Gene:WNT8B / 7479 HGNCID:12789 Length:351 Species:Homo sapiens


Alignment Length:295 Identity:90/295 - (30%)
Similarity:144/295 - (48%) Gaps:45/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 CEEQFRYDRWNC-----SIETRGKRNIFKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCSCG 333
            |:.||.:|||||     .:.:.|.   .:...:|||||||:::|.:.:::.|.|:.|....|.|.
Human    54 CKYQFAWDRWNCPERALQLSSHGG---LRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCD 115

  Fly   334 PKKHNR-EAQDFQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILRHDSEVGIEAVSSQMMDKC 397
            ..::.: ..|.:.||||:||:..|:.:::.|:|......|..:.:..|::|.|.:||...|...|
Human   116 DSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTC 180

  Fly   398 KCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIR-----KAPNQRSMRQVSSSRMKKPKQRR 457
            |||||||||:.:|||.::.:|......|::||:.|::     .|.|..:.|...:...:....|.
Human   181 KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRE 245

  Fly   458 KKPQQSQYTTLYYLETSPSYCAV--------TKDRQCLHPD---------NCGTLC--CGRGYTT 503
                      |.:||.||.||..        |:.|:||...         :|..||  ||.....
Human   246 ----------LVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEE 300

  Fly   504 QVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFC 538
            :..:.|..|.|:|:  .||.:.|:.|:|...||||
Human   301 RRAETVSSCNCKFH--WCCAVRCEQCRRRVTKYFC 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 90/295 (31%)
WNT8BNP_003384.2 WNT1 23..333 CDD:128408 88/293 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.