DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and WNT8A

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_016865313.1 Gene:WNT8A / 7478 HGNCID:12788 Length:408 Species:Homo sapiens


Alignment Length:286 Identity:87/286 - (30%)
Similarity:144/286 - (50%) Gaps:36/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 CEEQFRYDRWNC-----SIETRGKRNIFKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCSC- 332
            |:.||.::||||     .:.|   .|..:...:||:|:||:::|.:.:.|.:.|:.|....|.| 
Human    94 CKFQFAWERWNCPENALQLST---HNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCD 155

  Fly   333 GPKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDL--RGGDGDEVSEILRHDSEVGIEAVSSQMMD 395
            |..........:.||||:||::.|:|:::.|:|.  :|.|...:..:  |::..|..||.:.|..
Human   156 GSNNGKTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNL--HNNRAGRLAVRATMKR 218

  Fly   396 KCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKP 460
            .|||||:|||||::|||.::|:|......|:.||::|::...::|.:|..:|:...........|
Human   219 TCKCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLP 283

  Fly   461 QQSQYTTLYYLETSPSYCAV--------TKDRQCLHPD---------NCGTLC--CGRGYTTQVV 506
              |....|.:||.||.||..        |:.|:||...         :||.||  ||.....:..
Human   284 --SAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWERRSCGRLCTECGLQVEERKT 346

  Fly   507 KQVEKCRCRFNNGRCCQLICDYCQRL 532
            :.:..|.|:|.  .||.:.||.|:.:
Human   347 EVISSCNCKFQ--WCCTVKCDQCRHV 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 87/286 (30%)
WNT8AXP_016865313.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.