DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and WNT7B

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_011528668.1 Gene:WNT7B / 7477 HGNCID:12787 Length:353 Species:Homo sapiens


Alignment Length:331 Identity:108/331 - (32%)
Similarity:174/331 - (52%) Gaps:50/331 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLY--- 300
            |..:|. ..||...|:........:.|..::....|:.|||:.|||||  ..|::.:|.:..   
Human    42 CNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCS--ALGEKTVFGQELRVG 104

  Fly   301 -KETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKK--HNREAQDFQWGGCNDNLKHGKRVTRS 362
             :|.||.:|:|||.:.|::..||::|.::.|.|..:|  :..:|:.::||||:.::::|...:|.
Human   105 SREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRR 169

  Fly   363 FLDLRGGDGDEVSEILR-----HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATA 422
            |:|.|     |:.:..|     |::|.|.:.:..:|..:||||||||||:.||||..:..|....
Human   170 FVDAR-----EIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVG 229

  Fly   423 TLLRQKYNEAIRKAPNQRSMRQVSSSRMKKP-----KQRR--KKPQQSQYTTLYYLETSPSYC-- 478
            .||::|||.|::       :..|.:||:::|     ||.|  :||.:   |.|.|:|.||:||  
Human   230 HLLKEKYNAAVQ-------VEVVRASRLRQPTFLRIKQLRSYQKPME---TDLVYIEKSPNYCEE 284

  Fly   479 ------AVTKDRQCLH----PDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLE 533
                  ..|:.|.|..    .|.|.|:||||||.|....:|.:|.|:|:  .||.:.|:.|....
Human   285 DAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFH--WCCFVKCNTCSERT 347

  Fly   534 NKYFCK 539
            ..:.||
Human   348 EVFTCK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 104/322 (32%)
WNT7BXP_011528668.1 wnt_Wnt7b 36..353 CDD:381724 106/329 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.