DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and WNT7A

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_004616.2 Gene:WNT7A / 7476 HGNCID:12786 Length:349 Species:Homo sapiens


Alignment Length:354 Identity:114/354 - (32%)
Similarity:171/354 - (48%) Gaps:59/354 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 VFTSQG----QVGG-----------PCRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQ 277
            :|.|.|    ::||           .|..:|. ..||...|:........:.|..::....|:.|
Human    12 LFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQ 76

  Fly   278 FRYDRWNCSIETRGKRNIFKKLYK----ETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHN 338
            ||..|||||  ..|:|.:|.|..|    |.||.:|:.||.:.|:|..||.:|.::.|.|..:|..
Human    77 FRNGRWNCS--ALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQG 139

  Fly   339 REAQD--FQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILR-----HDSEVGIEAVSSQMMDK 396
            :..:|  ::||||:.::::|....:.|:|.|     |:.:..|     |::|.|.:.:...|..:
Human   140 QYHRDEGWKWGGCSADIRYGIGFAKVFVDAR-----EIKQNARTLMNLHNNEAGRKILEENMKLE 199

  Fly   397 CKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPK-QRRKKP 460
            ||||||||||:.||||..:..|.....:|:.|||||:...|       |.:||.|:|. .:.|||
Human   200 CKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP-------VRASRNKRPTFLKIKKP 257

  Fly   461 ---QQSQYTTLYYLETSPSYC--------AVTKDRQC----LHPDNCGTLCCGRGYTTQVVKQVE 510
               ::...|.|.|:|.||:||        ..|:.|.|    .....|..:||||||.|....:|.
Human   258 LSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVW 322

  Fly   511 KCRCRFNNGRCCQLICDYCQRLENKYFCK 539
            :|.|:|:  .||.:.|:.|......|.||
Human   323 QCNCKFH--WCCYVKCNTCSERTEMYTCK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 105/319 (33%)
WNT7ANP_004616.2 Wnt_Wnt7a 32..349 CDD:381723 107/332 (32%)
Disordered linker. /evidence=ECO:0000269|PubMed:30026314 238..266 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.