DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and WNT3

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_110380.1 Gene:WNT3 / 7473 HGNCID:12782 Length:355 Species:Homo sapiens


Alignment Length:412 Identity:129/412 - (31%)
Similarity:186/412 - (45%) Gaps:86/412 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 PHGHALAGLAKLGIIVPGGQGLPGNLGYGGT-MLNGGGVGGAAGMGLGIGSNTNNMDMQQGLYNE 218
            ||   |.||. ||:::            ||| :|.|..:..:..:|            ||     
Human     3 PH---LLGLL-LGLLL------------GGTRVLAGYPIWWSLALG------------QQ----- 34

  Fly   219 HFISEHTVMAVFTSQGQVGGPCRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDR 282
                       :||.|.....|..:|. ..:|...||....:..:::|..:|....|:.|||..|
Human    35 -----------YTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQHQFRGRR 88

  Fly   283 WNC-----SIETRGKRNIFKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQ 342
            |||     |:...|.  :..|..:|:|||||:.:|.:..::.|:||||..|.|.|.........:
Human    89 WNCTTIDDSLAIFGP--VLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHHKGPPGE 151

  Fly   343 DFQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILRHDSEVGIEAVSSQMMDKCKCHGVSGSCS 407
            .::||||:::...|..|:|.|.|.|....|..|.:.:|::|.|...:...|..||||||:||||.
Human   152 GWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCE 216

  Fly   408 MKTCWKKMADFNATATLLRQKYNEA----IRKAPNQRSMRQVSSSRMK----KPKQRRKKPQQSQ 464
            :||||....||.|....|:.||:.|    :.|  ::.|...|.:.|.|    ||...|       
Human   217 VKTCWWAQPDFRAIGDFLKDKYDSASEMVVEK--HRESRGWVETLRAKYSLFKPPTER------- 272

  Fly   465 YTTLYYLETSPSYCAV--------TKDRQC---LHP-DNCGTLCCGRGYTTQVVKQVEKCRCRFN 517
              .|.|.|.||::|..        |:||.|   .|. |.|..||||||:.|:..|:.|||.|.|:
Human   273 --DLVYYENSPNFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFH 335

  Fly   518 NGRCCQLICDYCQRLENKYFCK 539
              .||.:.|..|.|:.:.:.||
Human   336 --WCCYVSCQECIRIYDVHTCK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 107/317 (34%)
WNT3NP_110380.1 Wnt_Wnt3_Wnt3a 42..355 CDD:381709 109/327 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.