DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt5a

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_006252726.1 Gene:Wnt5a / 64566 RGDID:69250 Length:391 Species:Rattus norvegicus


Alignment Length:307 Identity:105/307 - (34%)
Similarity:153/307 - (49%) Gaps:49/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 LSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLY----KETAFVHALTAAAMTHSIARACA 323
            :.|..:.....|:.|||:.|||||  |....::|.::.    :||||.:|::||.:.::::|||.
  Rat   104 IGEGAKTGIKECQYQFRHRRWNCS--TVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACR 166

  Fly   324 EGRMTKCSCG----PKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDLRGGD------GDEVSEIL 378
            ||.::.|.|.    ||...|   |:.||||.||:.:|.|..:.|:|.|..:      ..|.:.||
  Rat   167 EGELSTCGCSRAARPKDLPR---DWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARIL 228

  Fly   379 R--HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRS 441
            .  |::|.|...|.:.....|||||||||||:||||.::|||......|::||:.|.....|.|.
  Rat   229 MNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRG 293

  Fly   442 MRQVSSSRMKKPKQRRKKPQQSQYTT--LYYLETSPSYCA--------VTKDRQCLHP----DNC 492
            .....:||...|            ||  |.|::.||.||.        .|:.|.|...    |.|
  Rat   294 KLVQVNSRFNSP------------TTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGC 346

  Fly   493 GTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
            ..:||||||......|.|:|.|:|:  .||.:.|..|..:.:::.||
  Rat   347 ELMCCGRGYDQFKTVQTERCHCKFH--WCCYVKCKKCTEIVDQFVCK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 103/305 (34%)
Wnt5aXP_006252726.1 Wnt_Wnt5a 80..391 CDD:381721 103/305 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.