DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wnt3a

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001007186.1 Gene:wnt3a / 60632 ZFINID:ZDB-GENE-001106-1 Length:365 Species:Danio rerio


Alignment Length:342 Identity:115/342 - (33%)
Similarity:174/342 - (50%) Gaps:41/342 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 FTSQGQVGGPCRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCS------- 286
            :||.|.....|..:|. ..:|...||....:..:::|..::....|:.|||..||||:       
Zfish    33 YTSLGTQPIMCSSIPGLVPKQLRFCRNYVEIMPSVAEGVKIGIQECQHQFRGRRWNCTTINDKLA 97

  Fly   287 -----IETRGKRNI-FK--KLYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQD 343
                 ::...:|.| ||  |..:|:|||||:.:|.:.. :.|||.||..|.|.|..::.....:.
Zfish    98 IFGPVLDKEKERKIGFKQAKATRESAFVHAIASAGVAFXVTRACTEGSATICGCDSRRKGPPGEG 162

  Fly   344 FQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILRHDSEVGIEAVSSQMMDKCKCHGVSGSCSM 408
            ::||||:::::.|..|:|.|.|.|....|..|.:.||::|.|..:::..|..||||||:||||.:
Zfish   163 WKWGGCSEDVEFGSMVSREFADARENRPDARSAMNRHNNEAGRSSITDHMYLKCKCHGLSGSCEV 227

  Fly   409 KTCWKKMADFNATATLLRQKYNEA----IRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLY 469
            ||||....||......::.||:.|    :.|  ::.|...|.:.|.|.|..  |.|.:   |.|.
Zfish   228 KTCWWSQPDFRVIGDYMKDKYDSASEMVVEK--HRESRGWVETLRPKYPYY--KPPTE---TDLV 285

  Fly   470 YLETSPSYCAV--------TKDRQC---LHP-DNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCC 522
            |.|:||::|..        |:||.|   .|. |.|..||||||:.|:..|:.|||.|.|:  .||
Zfish   286 YYESSPNFCEPNPETGSFGTRDRTCNLTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFH--WCC 348

  Fly   523 QLICDYCQRLENKYFCK 539
            .:.|..|.|:.:.:.||
Zfish   349 YVSCQECTRVYDVHTCK 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 108/323 (33%)
wnt3aNP_001007186.1 WNT1 45..365 CDD:128408 109/328 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.