DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and LOC568110

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_696514.2 Gene:LOC568110 / 568110 -ID:- Length:350 Species:Danio rerio


Alignment Length:329 Identity:109/329 - (33%)
Similarity:165/329 - (50%) Gaps:45/329 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLY--- 300
            |..:|. ..||...|:........:.|..::....|:.||::.|||||  ..|:|.:|.|..   
Zfish    38 CNKIPGLAPRQRIICQSRPDAIIVIGEGAQMGINECQFQFKHGRWNCS--ALGERTVFGKELKVG 100

  Fly   301 -KETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQD--FQWGGCNDNLKHGKRVTRS 362
             ||.||::|:.||.:.|:|..||..|.:::|||...|....|.|  ::||||:.::::|...::.
Zfish   101 SKEAAFMYAIIAAGVAHAITSACTRGNLSECSCDKDKQGFYAHDNGWKWGGCSADVRYGLGFSKV 165

  Fly   363 FLDLRGGDGDEVSEILR-----HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATA 422
            |:|.:     |:....|     |::|||.:.:...|..:||||||||||:.:|||..:..|....
Zfish   166 FMDAK-----EIKHSARTLMNLHNNEVGRKVLERNMRLECKCHGVSGSCATRTCWTTLPKFRELG 225

  Fly   423 TLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPK-QRRKKP---QQSQYTTLYYLETSPSYCAV--- 480
            .:|:.||..||...|       |.::|.|:|. .:.|||   ::...|.|.|:|.||:||..   
Zfish   226 YILKDKYTSAIHVEP-------VKATRHKRPTFLKIKKPYSYRKPMDTDLVYIEKSPNYCEADLR 283

  Fly   481 -----TKDRQC-----LHPDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENK 535
                 |:.|.|     .||:.|..:||||||.|....:|.:|.|:|  ..||.:.|:.|......
Zfish   284 SGSIGTQGRVCNKTLMHHPNGCDLMCCGRGYNTHQYSRVWQCNCKF--FWCCYVKCNTCSERTEV 346

  Fly   536 YFCK 539
            |.||
Zfish   347 YTCK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 105/320 (33%)
LOC568110XP_696514.2 wnt 44..350 CDD:278536 105/321 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.