DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wnt7aa

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001020711.1 Gene:wnt7aa / 565714 ZFINID:ZDB-GENE-051129-1 Length:349 Species:Danio rerio


Alignment Length:341 Identity:113/341 - (33%)
Similarity:173/341 - (50%) Gaps:48/341 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 FTSQGQVGGP--CRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRG 291
            |:|...:|..  |..:|. ..||...|:........:.|..::....|:.||:..|||||  ..|
Zfish    26 FSSVVALGASIICNKIPGLAPRQRTICQSRPDAIIVIGEGAQMGINECQFQFKNGRWNCS--ALG 88

  Fly   292 KRNIFKKLY----KETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKK---HNREAQDFQWGGC 349
            :|.:|.|..    ||.||.:|:.||.:.|:|..||.:|.::.|.|..:|   :|:| :.::||||
Zfish    89 ERTVFGKELKVGSKEAAFTYAIIAAGVAHAITAACTQGTLSGCGCDKEKQGFYNQE-EGWKWGGC 152

  Fly   350 NDNLKHGKRVTRSFLDLRGGDGDEVSEILR-----HDSEVGIEAVSSQMMDKCKCHGVSGSCSMK 409
            :.::::|...::.|||.|     |:.:..|     |::|||.:.:...|..:||||||||||:.|
Zfish   153 SADIRYGLSFSKVFLDAR-----EIKQNARTLMNLHNNEVGRKILEKNMRLECKCHGVSGSCTTK 212

  Fly   410 TCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPK-QRRKKP---QQSQYTTLYY 470
            |||..:..|.....:|:::||.|:...|       |.:||.|:|. .:.|||   ::...|.|.|
Zfish   213 TCWTTLPKFRQLGYILKERYNHAVHVEP-------VRASRNKRPAFLKVKKPYSYRKPMDTDLVY 270

  Fly   471 LETSPSYCAV--------TKDRQC----LHPDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQ 523
            :|.||:||..        |:.|.|    .|.:.|..:||||||.|....:|.:|.|:|.  .||.
Zfish   271 IEKSPNYCEADPVTGSMGTQGRICNKTAQHTNGCDLMCCGRGYNTHQYSRVWQCNCKFL--WCCY 333

  Fly   524 LICDYCQRLENKYFCK 539
            :.|:.|......|.||
Zfish   334 VKCNTCSERTEVYTCK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 106/320 (33%)
wnt7aaNP_001020711.1 wnt 44..349 CDD:278536 106/321 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.