DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wnt2bb

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001037809.1 Gene:wnt2bb / 556087 ZFINID:ZDB-GENE-060824-6 Length:396 Species:Danio rerio


Alignment Length:320 Identity:106/320 - (33%)
Similarity:163/320 - (50%) Gaps:31/320 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKR---NIFKKLY 300
            |..:|. ..:|...|:|...:..::....:.....|:.|||:.|||||...|...   .:.::..
Zfish    77 CDNIPGLVNKQRQLCQKYPDIMQSIGGGAKEWIRECQYQFRHHRWNCSALDRDHTVFGRVIQRSS 141

  Fly   301 KETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNR---EAQDFQWGGCNDNLKHGKRVTRS 362
            :|.|||:|:::|.:..:|.|||::|.:..|:|.|:|..|   |..:|.||||:||:.:|.:..::
Zfish   142 REAAFVYAISSAGVVFAITRACSQGELKACNCDPQKRGRASDERGEFDWGGCSDNINYGIKFAKA 206

  Fly   363 FLDLRGGDGDEVSEILR-HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLR 426
            |:|.:.....:...::. |::..|..||...|..:||||||||||:::|||..|:||..|...||
Zfish   207 FIDAKERTVKDARALMNLHNNRCGRMAVKRFMKLECKCHGVSGSCTLRTCWLAMSDFRKTGDYLR 271

  Fly   427 QKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAV--------TKD 483
            :|||.||     :.:|.|..:......|..||..:..    |.|.|.||.||.:        |..
Zfish   272 KKYNGAI-----EVTMNQDGTGFTVANKDFRKATKND----LVYFENSPDYCLMDKTAGSLGTAG 327

  Fly   484 RQC----LHPDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
            |.|    ...|.|..:||||||.|...|::.||.|:|.  .||.:.|..|:...:.:.||
Zfish   328 RVCNKTSRGTDGCEVMCCGRGYDTTRSKRITKCECKFK--WCCTVECKDCEEAVDIHTCK 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 102/311 (33%)
wnt2bbNP_001037809.1 wnt 83..385 CDD:278536 102/312 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.