DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wnt8a

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001017208.1 Gene:wnt8a / 549962 XenbaseID:XB-GENE-493706 Length:360 Species:Xenopus tropicalis


Alignment Length:297 Identity:88/297 - (29%)
Similarity:152/297 - (51%) Gaps:46/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 CEEQFRYDRWNCSIET--RGKRNIFKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKK 336
            |:.||.::||||...|  ....|..:...:||:||||:::|.:.:::.|.|:.|....|.|...:
 Frog    55 CKFQFAWERWNCPESTLQLATHNGLRSATRETSFVHAISSAGVMYTLTRNCSMGDFDNCGCDDSR 119

  Fly   337 HNR-EAQDFQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILR-----HDSEVGIEAVSSQMMD 395
            :.| ..:.:.||||:||.:.|:|:::.|:     ||.|..:..|     |::|.|..||...|..
 Frog   120 NGRIGGRGWVWGGCSDNAEFGERISKLFV-----DGLETGQDARALMNLHNNEAGRLAVKETMKR 179

  Fly   396 KCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKP 460
            .|||||:|||||::|||.::|:|......|:.|:::|::...::|.||..:|:       ..:..
 Frog   180 TCKCHGISGSCSVQTCWLQLAEFRDIGNHLKIKHDQALKLEMDKRKMRSGNSA-------DNRGA 237

  Fly   461 QQSQYTT-----LYYLETSPSYCAV--------TKDRQCLHPD---------NCGTLC--CGRGY 501
            ....:::     |.:||.||.||..        |:.|:||...         :|..||  ||...
 Frog   238 IADVFSSVAGSELIFLEDSPDYCLKNVSLGLQGTEGRECLQSGKNLSQWERRSCRRLCTDCGLRV 302

  Fly   502 TTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFC 538
            ..:..:.:..|.|:|:  .||.:.|:.|:::..|::|
 Frog   303 EERKTEIISSCNCKFH--WCCTVKCEQCKQVVIKHYC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 88/297 (30%)
wnt8aNP_001017208.1 Wnt_Wnt8a 32..338 CDD:381725 88/297 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.