DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and WNT4

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:XP_011539899.1 Gene:WNT4 / 54361 HGNCID:12783 Length:373 Species:Homo sapiens


Alignment Length:312 Identity:111/312 - (35%)
Similarity:165/312 - (52%) Gaps:30/312 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 RRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLY----KETAFVH 307
            :||...|::...:..::....:||...|:.|||..|||||  |.....:|.|:.    :|.|||:
Human    73 QRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCS--TLDSLPVFGKVVTQGTREAAFVY 135

  Fly   308 ALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDLR-GGDG 371
            |:::|.:..::.|||:.|.:.||.|....|....|.|||.||:||:.:|...::||:|:| ...|
Human   136 AISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKG 200

  Fly   372 DEVSEILR--HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIR 434
            ...|..|.  |::|.|.:|:.:.|..:||||||||||.:||||:.:..|......|::|::.|..
Human   201 ASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATE 265

  Fly   435 KAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAV--------TKDRQCLHP-- 489
            ..|     |:|.|||...|:..:.||...:  .|.|||.||.:|..        |:.|.|...  
Human   266 VEP-----RRVGSSRALVPRNAQFKPHTDE--DLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTSK 323

  Fly   490 --DNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
              |.|..||||||:.|..|:..|:|.|:|:  .||.:.|..||||...:.|:
Human   324 AIDGCELLCCGRGFHTAQVELAERCSCKFH--WCCFVKCRQCQRLVELHTCR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 110/310 (35%)
WNT4XP_011539899.1 wnt 71..373 CDD:278536 110/310 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.