DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and WNT16

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_476509.1 Gene:WNT16 / 51384 HGNCID:16267 Length:365 Species:Homo sapiens


Alignment Length:418 Identity:135/418 - (32%)
Similarity:196/418 - (46%) Gaps:94/418 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 ALAGLAKL-----GIIVPGGQGLPGNLGYGGTMLNGGGVGGAAGMGLGIGSNTNNMDMQQGLYNE 218
            ||.|||:|     .::|....|..||                 .|.|||.|              
Human     5 ALLGLARLCALWAALLVLFPYGAQGN-----------------WMWLGIAS-------------- 38

  Fly   219 HFISEHTVMAVFTSQGQVGGPCRYMPATRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRW 283
                       |....::|  |..:|...||...|:::..|..::.|..||....|..|||::||
Human    39 -----------FGVPEKLG--CANLPLNSRQKELCKRKPYLLPSIREGARLGIQECGSQFRHERW 90

  Fly   284 NCSIET------RGKRNIF----KKLYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHN 338
            ||.|..      .|...:|    ....|||||::|:.||.:.||:.|:|:.|.||:|||.....|
Human    91 NCMITAAATTAPMGASPLFGYELSSGTKETAFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQN 155

  Fly   339 --REAQDFQWGGCNDNLKHGKRVTRSFLDLRGGD--GDEVSEILR---HDSEVGIEAVSSQMMDK 396
              ..::.:.||||:|::::|...:|.|||...|:  |.|...:|.   |::|.|.:||:..|...
Human   156 GGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVD 220

  Fly   397 CKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQ 461
            |:||||||||::|||||.|:.|.....||:.||..:|:           .|.:.|:..:||:|.|
Human   221 CRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQ-----------ISDKTKRKMRRREKDQ 274

  Fly   462 QS---QYTTLYYLETSPSYCAV--------TKDRQCLH----PDNCGTLCCGRGYTTQVVKQVEK 511
            :.   ....|.|:..||:||..        |:.|:|..    .|.|..|||||||.|.||:.||:
Human   275 RKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVER 339

  Fly   512 CRCRFNNGRCCQLICDYCQRLENKYFCK 539
            |.|:|.  .||.:.|..|:.:.:.:.||
Human   340 CECKFI--WCCYVRCRRCESMTDVHTCK 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 114/324 (35%)
WNT16NP_476509.1 wnt 52..365 CDD:306592 114/325 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157953
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.