DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wntD

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:303 Identity:76/303 - (25%)
Similarity:122/303 - (40%) Gaps:75/303 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 ATTHCEEQFRYDRWNCSIETRGKRNI---FKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCS 331
            |...|::.|::.||||..:...::|.   .....:|..:|.|::.||:.|::.:.||.|.:..|.
  Fly    47 ALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGCG 111

  Fly   332 CG------PKKHN----REAQDFQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILRHDSEVGI 386
            |.      |..|.    .|..:..:|..:..:.|.:||              |..:|:...|   
  Fly   112 CTENALNVPCAHEPTKALEQYEKHFGSGSGAIGHNRRV--------------VGALLQRSLE--- 159

  Fly   387 EAVSSQMMDKCKCH---GVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSS 448
                    .:|:|.   .|.|.|..:.|...:..|.|.|..|.|.|::||:        .:.:||
  Fly   160 --------QECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQ--------LEGASS 208

  Fly   449 RMKKPKQRRKKPQQSQYTTLYYLETSPSYC--------AVTKDRQCLHPD--------NCGTLC- 496
            .:|...|  ..|..|    |.:::.||:||        ..|:.|||....        :|..|| 
  Fly   209 NLKIMWQ--NIPLDS----LVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCR 267

  Fly   497 -CGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFC 538
             ||....:|.|:...:|.|:...|  .:|.||.|.:||.:|.|
  Fly   268 VCGYRVRSQHVRTERRCNCKLVWG--FRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 76/303 (25%)
wntDNP_650272.1 wnt 41..308 CDD:302926 75/301 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.