DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt6

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster


Alignment Length:397 Identity:113/397 - (28%)
Similarity:170/397 - (42%) Gaps:125/397 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 NHQCRKETGLPGTLSEARR---------------LATTHCEEQFRYDRWNCSIETRGKRNIFKKL 299
            |..|:|...|.|.|:|..|               |....||.|||..||||::..:..|.|..:.
  Fly    32 NLMCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNCTVLRKSMRKILMRD 96

  Fly   300 YKETAFVHALTAAAMTHSIARACAEGRMTKCSC-------------------------------- 332
            .:||.||:|:|||.:|:::.:||..|::.:|||                                
  Fly    97 SRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAM 161

  Fly   333 ----------------------------GPKKH----NR------------------EAQDFQWG 347
                                        .|.:|    ||                  |.| ::||
  Fly   162 LRQQMPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQ-WEWG 225

  Fly   348 GCNDNLKHGKRVTRSFLDL--RGGDGDEVSEILRHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKT 410
            ||:||:..|.|.:|.|||.  |....|..:.:..|::..|..|:...|..:|||||:||||::||
  Fly   226 GCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKT 290

  Fly   411 CWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSP 475
            ||.||..|...|..||.:|:.| ||.    ::|...:|.|  |:....:| .::| .|.:.:.||
  Fly   291 CWLKMPPFREVAGRLRDRYDSA-RKV----TLRNDGNSFM--PESPHARP-ANKY-QLVFADDSP 346

  Fly   476 SYCAV--------TKDRQC----LHPDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDY 528
            .:|..        |:.|:|    ...|.|..|||.||:|.::|::...|:|.|.  .||::.|:.
  Fly   347 DFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFK--WCCEVTCEK 409

  Fly   529 CQRLENK 535
            |  ||::
  Fly   410 C--LEHR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 113/397 (28%)
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 110/388 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456817
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D280593at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.