DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt10a

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001101697.1 Gene:Wnt10a / 316527 RGDID:1307015 Length:417 Species:Rattus norvegicus


Alignment Length:359 Identity:110/359 - (30%)
Similarity:172/359 - (47%) Gaps:61/359 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNC-SIETRGK----RNIFKK 298
            |..:|. :|||...|.:...:..:..:..::|...|:.|||..|||| |:|||.|    ..||.:
  Rat    61 CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKVPYESPIFSR 125

  Fly   299 LYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNRE----------------------- 340
            .::|:||.:|:.||.:.|:::.|||.|::..|.|...:...|                       
  Rat   126 GFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLDALQRGKGLSH 190

  Fly   341 --------------AQD-FQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILRHDSEVGIEAVS 390
                          .|| ::||||:.::..|:|.::.|||.|....|..:.:..|::.||.:||.
  Rat   191 GVPEHPAIPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHARMRLHNNRVGRQAVM 255

  Fly   391 SQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQ 455
            ..|..||||||.||||.:||||:...:|.....|||.:::.|....|:.|:..|:.......|..
  Rat   256 ENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRNRFHRATLIRPHNRNGGQLEPGLAGAPSP 320

  Fly   456 RRKKP---QQSQYTTLYYLETSPSYC--------AVTKDRQC----LHPDNCGTLCCGRGYTTQV 505
            ....|   :::.::.|.|.|.||.:|        |.|..|.|    ..||:||::|||||:....
  Rat   321 APGTPGLRRRASHSDLVYFEKSPDFCEREPRLDSAGTVGRLCNKSSTGPDSCGSMCCGRGHNILR 385

  Fly   506 VKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
            ..:.|:|.|||:  .||.::|:.|:..|....||
  Rat   386 QTRSERCHCRFH--WCCFVVCEECRITEWVSVCK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 106/350 (30%)
Wnt10aNP_001101697.1 wnt 67..417 CDD:278536 106/351 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.