DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt6

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001101696.1 Gene:Wnt6 / 316526 RGDID:1304559 Length:365 Species:Rattus norvegicus


Alignment Length:349 Identity:108/349 - (30%)
Similarity:161/349 - (46%) Gaps:59/349 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 VGGP--------CRYMPATR---RQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIET 289
            ||.|        ||  .|.|   ||...|:.|..:...|:...||....|:.|||:.|||||..:
  Rat    29 VGSPLVMDPTSICR--KARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHS 91

  Fly   290 RGKRNIFKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCSC---------------------G 333
            :....:.::..:|||||.|:|||..:|::.:||:.|.:.:|.|                     |
  Rat    92 KAFGRVLQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPG 156

  Fly   334 PKKHNREAQDFQWGGCNDNLKHGKRVTRSFLDL--RGGDGDEVSEILRHDSEVGIEAVSSQMMDK 396
            |......:..::||||.|::..|...:|.|:|.  :.|.||..:.:..|::|.|..||.|....:
  Rat   157 PTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTE 221

  Fly   397 CKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQ 461
            |||||:||||:::|||:|:..|......|.::::.|.|..........:.:.|..||..|     
  Rat   222 CKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGR----- 281

  Fly   462 QSQYTTLYYLETSPSYCAV--------TKDRQC--LHPD--NCGTLCCGRGYTTQVVKQVEKCRC 514
                ..|.|...||.:||.        |:.|.|  ..||  .|..||||||:..:.|:..|.|.|
  Rat   282 ----ADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLC 342

  Fly   515 RFNNGRCCQLICDYCQRLENKYFC 538
            ||:  .||.:.|..|:..:....|
  Rat   343 RFH--WCCVVQCHRCRVRKELSLC 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 102/331 (31%)
Wnt6NP_001101696.1 Wnt_Wnt6 35..365 CDD:381712 105/343 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D280593at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.