DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and Wnt3a

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001100475.2 Gene:Wnt3a / 303181 RGDID:1308057 Length:359 Species:Rattus norvegicus


Alignment Length:325 Identity:107/325 - (32%)
Similarity:160/325 - (49%) Gaps:39/325 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNC-----SIETRGKRNIFKK 298
            |..:|. ..:|...||....:..:::|..:.....|:.|||..||||     |:...|.  :..|
  Rat    49 CASIPGLVPKQLRFCRNYVEIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGP--VLDK 111

  Fly   299 LYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQDFQWGGCNDNLKHGKRVTRSF 363
            ..:|:|||||:.:|.:..::.|:||||....|.|..:......:.::||||:::::.|..|:|.|
  Rat   112 ATRESAFVHAIASAGVAFAVTRSCAEGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREF 176

  Fly   364 LDLRGGDGDEVSEILRHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQK 428
            .|.|....|..|.:.||::|.|.:|::|.|..||||||:||||.:||||....||......|:.|
  Rat   177 ADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDK 241

  Fly   429 YNEA----IRKAPNQRSMRQVSSSR---MKKPKQRRKKPQQSQYTTLYYLETSPSYCAV------ 480
            |:.|    :.|....|...:....|   .|.|.:|          .|.|.|.||::|..      
  Rat   242 YDSASEMVVEKHRESRGWVETLRPRYTYFKVPTER----------DLVYYEASPNFCEPNPETGS 296

  Fly   481 --TKDRQC---LHP-DNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
              |:||.|   .|. |.|..||||||:..:..::.|||.|.|:  .||.:.|..|.|:.:.:.||
  Rat   297 FGTRDRTCNVSSHGIDGCDLLCCGRGHNARTERRREKCHCVFH--WCCYVSCQECTRVYDVHTCK 359

  Fly   540  539
              Rat   360  359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 103/316 (33%)
Wnt3aNP_001100475.2 WNT1 51..359 CDD:128408 104/321 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.