DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wnt10b

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_835737.1 Gene:wnt10b / 30308 ZFINID:ZDB-GENE-980526-524 Length:427 Species:Danio rerio


Alignment Length:383 Identity:112/383 - (29%)
Similarity:166/383 - (43%) Gaps:99/383 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNC-SIETRGK----RNIFKKLYKETAF 305
            |::|...|.:...:..:..:..::|...|:.|.|..|||| |:|..||    ..|..:.::|:||
Zfish    55 TKKQMRLCVRSPDVTASALQGIQVAIHECQHQLRDQRWNCSSLENHGKLPHQSAILNRGFRESAF 119

  Fly   306 VHALTAAAMTHSIARACAEGRMTKCSCGPKKH-----------NREAQDFQ-------------- 345
            ..:|.||.:.||:|.||:.|::..|.|..|:.           ..:.|.||              
Zfish   120 SLSLLAAGVVHSVASACSLGKLRGCGCEAKRRLDDDKIRLKLTQLQLQTFQRSGVSLAGAGENTP 184

  Fly   346 -------------------------------------WGGCNDNLKHGKRVTRSFLDLRGGDGDE 373
                                                 ||||:.:::.|.|.:|.:||.||...|.
Zfish   185 ELSSLHGSLPANLHSSHPMSLLKPLPDEVTMLQDTWEWGGCSHDIRFGVRFSRDWLDSRGSPRDI 249

  Fly   374 VSEILRHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAI----- 433
            .:....|::.||.:.|:..|..||||||.||||..||||....:|....:|||:|:..||     
Zfish   250 HARTRIHNNRVGRQVVTDNMRRKCKCHGTSGSCQFKTCWYVSPEFRLVGSLLREKFLTAIFINSQ 314

  Fly   434 ---RKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYC----AV----TKDRQCL 487
               ....|.|:.....|..::  .|||:...:.    |.|.|.||.:|    ||    |:.|.|.
Zfish   315 NKNNGVFNSRTGGSTGSDPLR--GQRRRSISRE----LVYFEKSPDFCDREPAVDSLGTQGRICN 373

  Fly   488 HP----DNCGTLCCGRGYTTQVVKQV--EKCRCRFNNGRCCQLICDYCQRLENKYFCK 539
            ..    |.||:||||||:  .::||.  |:|.|||:  .||.::|:.|:..|....||
Zfish   374 KSSPGMDGCGSLCCGRGH--NILKQARSERCHCRFH--WCCYVLCEECKVTEWVNVCK 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 110/381 (29%)
wnt10bNP_835737.1 wnt 50..427 CDD:306592 110/381 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.