DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt4 and wnt11

DIOPT Version :9

Sequence 1:NP_001260187.1 Gene:Wnt4 / 34007 FlyBaseID:FBgn0010453 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_571151.1 Gene:wnt11 / 30283 ZFINID:ZDB-GENE-980526-249 Length:352 Species:Danio rerio


Alignment Length:328 Identity:114/328 - (34%)
Similarity:167/328 - (50%) Gaps:46/328 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CRYMPA-TRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCS----------IETRGKR 293
            |:.:|. ...|...||....|..|:.:|.|.....|::.|...|||||          :| ||.|
Zfish    43 CKTLPGLVSSQAQLCRSNLELMQTIIQAAREVKKVCQKTFTDMRWNCSSIDGPKFLPDLE-RGTR 106

  Fly   294 NIFKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQDFQWGGCNDNLKHGKR 358
                    |:|||:||:|||::|:|||||..|.:..|||||.........::||||.||:.:|..
Zfish   107 --------ESAFVYALSAAAISHTIARACTSGDLRLCSCGPIPGEIPEPGYRWGGCADNIHYGLL 163

  Fly   359 VTRSFLD----LRGGDGDEVSEILR-HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADF 418
            :...|.|    ::...|...::::. |:||||.:|:...::.||||||||||||::|||:.:.|.
Zfish   164 MGSKFSDAPMKMKKKSGSHANKLMHLHNSEVGRQALRDALVMKCKCHGVSGSCSIRTCWRGLLDL 228

  Fly   419 NATATLLRQKYNEAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAV--- 480
            ...|..|:.||..|.:..     .|.:.:.:...||....:|.:.  ..|.||::||.||..   
Zfish   229 KDIAIDLKTKYLSATKVV-----HRPMGTRKQLVPKDIDIRPVRE--NELVYLQSSPDYCMKNDK 286

  Fly   481 -----TKDRQC----LHPDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKY 536
                 |:||||    ...|:|..:||||||.....:.||:|.|:::  .||.:.|..|.:...||
Zfish   287 LGSFGTQDRQCNKTSSGSDSCDLMCCGRGYNPYTERVVERCHCKYH--WCCYVTCKKCDKTVEKY 349

  Fly   537 FCK 539
            .||
Zfish   350 VCK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt4NP_001260187.1 wnt 246..539 CDD:278536 110/319 (34%)
wnt11NP_571151.1 wnt 49..352 CDD:278536 110/320 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12027
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.